PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00763g00441.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 322aa    MW: 37140.2 Da    PI: 5.4331
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00763g00441.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding543.8e-171461148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
           Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                              +g W++eEde+l+++++++G g+W+++++  g+ R++k+c++rw +yl
  Peaxi162Scf00763g00441.1 14 KGLWSPEEDEKLYNYITKFGVGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                              678*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.866965IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.1E-24964IPR009057Homeodomain-like
SuperFamilySSF466891.98E-221297IPR009057Homeodomain-like
SMARTSM007171.3E-121363IPR001005SANT/Myb domain
PfamPF002494.6E-151461IPR001005SANT/Myb domain
CDDcd001677.23E-111761No hitNo description
Gene3DG3DSA:1.10.10.604.7E-1365106IPR009057Homeodomain-like
SMARTSM007170.05666103IPR001005SANT/Myb domain
PROSITE profilePS512947.2766105IPR017930Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MGRHSSFVKE KLRKGLWSPE EDEKLYNYIT KFGVGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGMF SQEEEDMIIS LHQVLGNRTD NEIKNFWNSY LKKKLIKQGI DPNTHQPLSE  120
NQVRNETDCK DKASTSTQIQ QPFNLSKRNF NYEASRQLTE ASKDQLVSKQ VFDPLFLYEF  180
QANVNPSGYN LRPYDHNQNQ IEGNTNFGFF SMPSLTNFEQ GHMTETDFSE SSSSRMSLLY  240
ISEAKESSSN SSNMISHHNA AGIQMNEMLE NSQALSWDVD NKIDSLFQYP YDGIKNEEDF  300
NNPLSSLSED LSGENLDVFH QI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-19121055108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016473082.11e-176PREDICTED: myb-related protein 330-like isoform X2
TrEMBLM1CKU41e-157M1CKU4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000696441e-156(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.11e-66myb domain protein 86